
Western blot analysis of extracts of various cells.
CCR8 / CD198 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409587-20
Catalog Number: LS-C409587
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD198 antibody LS-C409587 is an unconjugated rabbit polyclonal antibody to CD198 (CCR8) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-C chemokine receptor type 8 | CC chemokine receptor CHEMR1 | CC-CKR-8 | Chemokine (C-C) receptor 8 | CDw198 antigen | CKRL1 | CMKBR8 | Chemokine receptor-like 1 | CMKBRL2 | CCR8 | CKR-L1 | GPRCY6 | TER1 | C-C CKR-8 | CC chemokine receptor 8 | CC-chemokine receptor chemr1 | CCR-8 | CDw198 | CY6 | GPR-CY6 | CD198
- UniProt Number
- P51685
- NCBI GenBank
- NM_005201 | NP_005192.1
- SwissProt
- P51685
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human CCR8 / CD198
- Antigen Species
- Human
- Epitope
- Human CCR8
- Gene Name
- CCR8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 296-355 of human CCR8 (NP_005192.1). NPVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
