IHC staining of FFPE human esophageal squamous cancer with CCR10 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
CCR10 / GPR2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782292-100
Catalog Number: LS-C782292
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GPR2 antibody LS-C782292 is an unconjugated rabbit polyclonal antibody to human GPR2 (CCR10). Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-C CKR-10 | CC-CKR-10 | CCR-10 | C-C chemokine receptor type 10 | CC chemokine receptor 10 | CCR10 | G-protein coupled receptor 2 | GPR2 | G protein-coupled receptor 2
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P46092
- NCBI GenBank
- NM_016602 | NP_057686.2
- SwissProt
- P46092
Target
- Target
- Human CCR10 / GPR2
- Antigen Species
- Human
- Gene Name
- CCR10
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ from the human protein were used as the immunogen for the CCR10 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS