
Western blot testing of 1) rat kidney, 2) mouse spleen and 3) human Jurkat lysate with Cyclin T1 antibody at 0.5ug/ml. Predicted/observed molecular weight ~81 kDa.
CCNT1 / Cyclin T1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781808-100
Catalog Number: LS-C781808
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cyclin T1 antibody LS-C781808 is an unconjugated rabbit polyclonal antibody to Cyclin T1 (CCNT1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CCNT | CDK9-associated C-type protein | Cyclin T1b | CYCT1 | CCNT1 | Cyclin T1 | HIVE1 | Cyclin C-related protein | Cyclin-T | Cyclin-T1
- UniProt Number
- O60563
- NCBI GenBank
- NM_001240 | NP_001231.2
- SwissProt
- O60563
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human CCNT1 / Cyclin T1
- Antigen Species
- Human
- Gene Name
- CCNT1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM from the human protein were used as the immunogen for the Cyclin T1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
