Western blot testing of 1) rat heart, 2) mouse NIH 3T3 and 3) human HeLa lysate with KRIT1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~84 kDa.
CCM1 / KRIT1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781875-100
Catalog Number: LS-C781875
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- KRIT1 antibody LS-C781875 is an unconjugated rabbit polyclonal antibody to KRIT1 (CCM1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CaM | CCM1 | Krev interaction trapped 1 | KRIT1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- O00522
- NCBI GenBank
- NM_004912 | NP_004903.2
- SwissProt
- O00522
Target
- Target
- Human CCM1 / KRIT1
- Antigen Species
- Human
- Gene Name
- KRIT1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS