Western blot - Anti-KRIT1 Picoband Antibody
CCM1 / KRIT1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662359-100
Catalog Number: LS-C662359
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- KRIT1 antibody LS-C662359 is an unconjugated rabbit polyclonal antibody to human KRIT1 (CCM1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CaM | CCM1 | Krev interaction trapped 1 | KRIT1
- UniProt Number
- O00522
- NCBI GenBank
- NM_004912 | NP_004903.2
- SwissProt
- O00522
Target
- Target
- Human CCM1 / KRIT1
- Antigen Species
- Human
- Epitope
- Low levels in brain. Very weak expression found in heart and muscle. .
- Gene Name
- KRIT1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human KRIT1 (703-736 aa ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS), different from the related mouse sequence by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl