Immunohistochemistry of paraffin-embedded human liver tissue.
CCL8 / MCP2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409097-20
Catalog Number: LS-C409097
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MCP2 antibody LS-C409097 is an unconjugated rabbit polyclonal antibody to human MCP2 (CCL8). Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-C motif chemokine 8 | CCL8 | HC14 | MCP2 | Monocyte chemotactic protein 2 | Scya10 | SCYA8 | Small-inducible cytokine A8 | MCP-2 | Chemokine (C-C motif) ligand 8
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P80075
- NCBI GenBank
- NM_005623 | NP_005614.2
- SwissProt
- P80075
Target
- Target
- Human CCL8 / MCP2
- Antigen Species
- Human
- Epitope
- Human CCL8 / MCP2
- Gene Name
- CCL8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 23-99 of human CCL8 (NP_005614.2). AQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS