Western blot analysis of extracts of various cells.

CCL27 Antibody

Name: CCL27 Antibody
Brand: LSBio
SKU: LS-C411380-20
Price: 281 USD
Availability: InStock

$281.00each

Catalog Number: LS-C411380-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: CCL27 antibody LS-C411380 is an unconjugated rabbit polyclonal antibody to CCL27 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ALP | Chemokine alp | C-C motif chemokine 27 | CC chemokine ILC | CTAK | ESKINE | IL-11 R-alpha-locus chemokine | ILC | IL-11 Ralpha-locus chemokine | PESKY | SCYA27 | Skinkine | CCL27 | CTACK | Il-11r alpha-locus chemokine | Small-inducible cytokine A27
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9Y4X3
NCBI GenBank: NM_006664 | NP_006655.1
SwissProt: Q9Y4X3

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-112 of human CCL27 (NP_006655.1). FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)