Western blot analysis of extracts of Jurkat cells.
CCL24 / Eotaxin 2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C335266-20
Catalog Number: LS-C335266
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Eotaxin 2 antibody LS-C335266 is an unconjugated rabbit polyclonal antibody to mouse Eotaxin 2 (CCL24). Validated for WB.
- Application
- WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CCL24 | C-C motif chemokine 24 | Ckb-6 | CK-beta-6 | Eotaxin2 | MPIF-2 | MPIF2 | SCYA24 | Small-inducible cytokine A24 | Eotaxin-2
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- O00175
- NCBI GenBank
- NM_002991 | NP_002982.2
- SwissProt
- O00175
Target
- Target
- Human CCL24 / Eotaxin 2
- Antigen Species
- Human
- Epitope
- Human CCL24 / Eotaxin 2
- Gene Name
- CCL24
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 40-119 of human CCL24 (NP_002982.2). KRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS