Western blot analysis of extracts of various cell lines, using CCL20 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5min.
CCL20 / MIP-3-Alpha Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C746793-20
Catalog Number: LS-C746793
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MIP-3-Alpha antibody LS-C746793 is an unconjugated rabbit polyclonal antibody to human MIP-3-Alpha (CCL20). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Beta chemokine exodus-1 | CCL20 | Beta-chemokine exodus-1 | CKb4 | Exodus-1 | MIP-3a | MIP-3-alpha | LARC | ST38 | SCYA20 | C-C motif chemokine 20 | CC chemokine LARC | Mip-3alpha | MIP3A | Small-inducible cytokine A20
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P78556
- NCBI GenBank
- NM_004591 | NP_004582.1
- SwissProt
- P78556
Target
- Target
- Human CCL20 / MIP-3-Alpha
- Antigen Species
- Human
- Gene Name
- CCL20
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 1-95 of human CCL20 (NP_001123518.1). MCCTKSLLLAALMSVLLLHLCGESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS