Western blot testing of human 1) PANC-1, 2) U-87 MG, 3) COLO-320 and 4) SGC-7901 cell lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
CCKBR / Cckb Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782111-100
Catalog Number: LS-C782111
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cckb antibody LS-C782111 is an unconjugated rabbit polyclonal antibody to Cckb (CCKBR) from human. It is reactive with human, mouse and rat. Validated for Flow and WB.
- Application
- FC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CCKB | CCKBR | Cholecystokinin-2 receptor | CCK-BR | CCK2 receptor | CCK2-R | CCKB-R | Cholecystokinin-B | GASR | CCK-B | CCK-B receptor | CCK2R | Cckb receptor | CCKRB | Cholecystokinin B receptor | Gastrin receptor
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P32239
- NCBI GenBank
- NM_176875 | NP_795344.1
- SwissProt
- P32239
Target
- Target
- Human CCKBR / Cckb
- Antigen Species
- Human
- Gene Name
- CCKBR
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids PVYTVVQPVGPRVLQCVHRWPSARVRQTWS were used as the immunogen for the CCKBR antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS