
Western blot - Anti-CCKBR Picoband antibody
CCKBR / Cckb Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Frozen, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662556-100
Catalog Number: LS-C662556
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cckb antibody LS-C662556 is an unconjugated rabbit polyclonal antibody to human Cckb (CCKBR). Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC, IHC-F, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CCKB | CCKBR | Cholecystokinin-2 receptor | CCK-BR | CCK2 receptor | CCK2-R | CCKB-R | Cholecystokinin-B | GASR | CCK-B | CCK-B receptor | CCK2R | Cckb receptor | CCKRB | Cholecystokinin B receptor | Gastrin receptor
- UniProt Number
- P32239
- NCBI GenBank
- NM_176875 | NP_795344.1
- SwissProt
- P32239
Target
- Target
- Human CCKBR / Cckb
- Antigen Species
- Human
- Epitope
- Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.
- Gene Name
- CCKBR
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
