Immunofluorescence analysis of U2OS cells using CBX5 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
CBX5 / HP1 Alpha Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$293.00each
Catalog Number: LS-C747673-20
Catalog Number: LS-C747673
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HP1 Alpha antibody LS-C747673 is an unconjugated rabbit polyclonal antibody to HP1 Alpha (CBX5) from human. It is reactive with human and mouse. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CBX5 | Chromobox homolog 5 | HP1Hs alpha | HP1Hs-alpha | HP1 | HP1 alpha homolog | HP1 alpha | HP1-ALPHA | HP1A | Antigen p25 | Chromobox protein homolog 5
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P45973
- NCBI GenBank
- NM_012117 | NP_036249.1
- SwissProt
- P45973
Target
- Target
- Human CBX5 / HP1 Alpha
- Antigen Species
- Human
- Gene Name
- CBX5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CBX5 (NP_001120794.1). MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS