RUNX2 antibody Western blot. All lanes: Anti RUNX2 at 0.5 ug/ml. WB: Recombinant Human RUNX2 Protein 0.5ng. Predicted band size: 50 kD. Observed band size: 50 kD.
CBFA1 / RUNX2 Antibody (aa244-278)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Non-Human Primate, Pig |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C344017-100
Catalog Number: LS-C344017
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RUNX2 antibody LS-C344017 is an unconjugated rabbit polyclonal antibody to RUNX2 (CBFA1) (aa244-278) from human. It is reactive with human, mouse, chimpanzee and other species. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, NHP, Por
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AML3 | CCD | CCD1 | OSF2 | PEBP2A1 | PEBP2A2 | PEA2-alpha A | PEBP2-alpha A | OSF-2 | PEBP2A | PEBP2aA1 | RUNX2 | CBF-alpha-1 | CBFA1 | Oncogene AML-3 | PEA2aA | PEBP2aA
- UniProt Number
- Q13950
- NCBI GenBank
- NM_004348 | NP_004339.3
- SwissProt
- Q13950
Target
- Target
- Human CBFA1 / RUNX2
- Antigen Species
- Human
- Epitope
- Specifically expressed in osteoblasts.
- Gene Name
- RUNX2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278 aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl