Western blot analysis of extracts of mouse testis, using CALY antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

CALY Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C497207-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CALY antibody LS-C497207 is an unconjugated rabbit polyclonal antibody to mouse CALY. Validated for WB.
Application: WB
Reactivity: Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Calcyon protein | CALCYON | CALY | NSG3 | RP11-122K13.5 | DRD1IP
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9NYX4
NCBI GenBank: NM_015722 | NP_056537.1
SwissProt: Q9NYX4

Target

Target: Human CALY
Antigen Species: Human
Gene Name: CALY

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CALY (NP_056537.1). MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTAR
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)