Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Calcitonin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Radioimmunoassay |
| Reactivity: | Human, Non-Human Primate |
| Format: | Lyophilized |
$458.00each
Catalog Number: LS-C127172-20
Catalog Number: LS-C127172
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Calcitonin antibody LS-C127172 is an unconjugated rabbit polyclonal antibody to Calcitonin from human. It is reactive with human and monkey. Validated for RIA.
- Application
- RIA
- Reactivity
- Hu, NHP
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
Target
- Target
- Human Calcitonin
- Antigen Species
- Human
- Epitope
- Recognizes Human Calcitonin. There were no cross reactivities obtained with human Katacalcin and human Calcitonin Gene related Peptide.
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- Synthetic human Calcitonin, BSA-conjugated(CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP). Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Rat, Hamster (94%); Mouse, Panda, Dog, Horse (90%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
