Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
CALCB Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Goat Polyclonal |
| Applications: | Radioimmunoassay |
| Reactivity: | Human |
| Format: | Lyophilized |
$493.00each
Catalog Number: LS-C127170-20
Catalog Number: LS-C127170
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CALCB antibody LS-C127170 is an unconjugated goat polyclonal antibody to human CALCB. Validated for RIA.
- Application
- RIA
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Beta-type CGRP | Beta-CGRP | CALC2 | Calcitonin 2 | CGRP-II | CALCB | CGRP2
- UniProt Number
- P10092
- NCBI GenBank
- NP_000719.1
- SwissProt
- P10092
Target
- Target
- Human CALCB
- Antigen Species
- Human
- Epitope
- Recognizes human Calcitonin-Gene related Peptide 2. There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin.
- Gene Name
- CALCB
Antibody
- Host Species
- Goat
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic human Calcitonin Gene-related Peptide, bTG- conjugated (ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Elephant (97%); Sheep, Pig (94%); Mouse, Rat, Dog, Horse (90%); Panda, Salmon, Medaka, Pufferfish (87%); Hamster, Chicken (84%); Zebrafish (81%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, pH 7.2
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
- Recommended Storage Buffer
- PBS
