
Immunohistochemistry of paraffin-embedded human stomach using CA9 antibody at dilution of 1:100 (40x lens).
CA9 / Carbonic Anhydrase IX Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C748717-20
Catalog Number: LS-C748717
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Carbonic Anhydrase IX antibody LS-C748717 is an unconjugated rabbit polyclonal antibody to Carbonic Anhydrase IX (CA9) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CA9 | CAIX | Carbonate dehydratase IX | Carbonic anhydrase IX | CA-IX | Carbonic dehydratase | G250 | MN | Membrane antigen MN | p54/58N | RCC-associated antigen G250 | RCC-associated protein G250 | Carbonic anhydrase 9 | PMW1 | CA IX
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q16790
- NCBI GenBank
- NM_001216 | NP_001207.2
- SwissProt
- Q16790
Target
- Target
- Human CA9 / Carbonic Anhydrase IX
- Antigen Species
- Human
- Gene Name
- CA9
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 52-151 of human CA9 (NP_001207.2). GSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPR
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
