Western blot analysis of extracts of various cell lines, using CARD19 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

C9orf89 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C748257-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: C9orf89 antibody LS-C748257 is an unconjugated rabbit polyclonal antibody to C9orf89 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: BA370F5.1 | Bcl10-interacting CARD protein | BinCARD | C9orf89
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q96LW7
NCBI GenBank: NM_032310 | NP_115686.3
SwissProt: Q96LW7

Target

Target: Human C9orf89
Antigen Species: Human
Gene Name: CARD19

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CARD19 (NP_115686.3). MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHA
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)