
Western blot analysis of extracts of various cells.
C4BPA / C4BP Alpha Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409202-20
Catalog Number: LS-C409202
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- C4BP Alpha antibody LS-C409202 is an unconjugated rabbit polyclonal antibody to C4BP Alpha (C4BPA) from human. It is reactive with human and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C4BPA | C4BP | PrP | Proline-rich protein
- UniProt Number
- P04003
- NCBI GenBank
- NM_000715 | NP_000706.1
- SwissProt
- P04003
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:200 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human C4BPA / C4BP Alpha
- Antigen Species
- Human
- Epitope
- Human C4BPA / C4BP Alpha
- Gene Name
- C4BPA
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 500 to the C-Terminus of human C4BPA (NP_000706.1). QYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
