Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot analysis of extracts of various cell lines, using MAF antibody.
c-Maf Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C335380-20
Catalog Number: LS-C335380
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- C-Maf antibody LS-C335380 is an unconjugated rabbit polyclonal antibody to c-Maf from human. It is reactive with human and mouse. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-MAF | CCA4 | C-maf proto-oncogene | Proto-oncogene c-Maf | T lymphocyte c-maf long form | MAF | Transcription factor Maf
- Recommended Dilution: WB
- 1:1000 - 1:3000
- UniProt Number
- O75444
- NCBI GenBank
- NM_005360, NP_005351.2
- SwissProt
- O75444
Target
- Target
- Human c-Maf
- Antigen Species
- Hu
- Epitope
- Human c-Maf
- Gene Name
- MAF
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human MAF (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
