
Western blot testing of human 1) HEK293, 2) Jurkat, 3) CCRF-CEM and 4) mouse thymus lysate with CD272 antibody at 0.5ug/ml. Predicted molecular weight: 33-60 kDa depending on level of glycosylation.
BTLA / CD272 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782854-100
Catalog Number: LS-C782854
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD272 antibody LS-C782854 is an unconjugated rabbit polyclonal antibody to CD272 (BTLA) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BTLA | BTLA1 | B and T lymphocyte associated | CD272 | B and T lymphocyte attenuator | B- and T-lymphocyte attenuator | CD272 antigen
- UniProt Number
- Q7Z6A9
- SwissProt
- Q7Z6A9
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human BTLA / CD272
- Antigen Species
- Human
- Gene Name
- BTLA
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL were used as the immunogen for the CD272 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
