Western blot analysis of extracts of various cell lines, using BTK antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

BTK Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C747820-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: BTK antibody LS-C747820 is an unconjugated rabbit polyclonal antibody to BTK from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: AGMX1 | AT | ATK | XLA | PSCTK1 | B-cell progenitor kinase | BPK | Bruton tyrosine kinase | BTK | Tyrosine-protein kinase BTK | IMD1
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q06187
NCBI GenBank: NM_000061 | NP_000052.1
SwissProt: Q06187

Target

Target: Human BTK
Antigen Species: Human
Gene Name: BTK

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 173-272 of human BTK (NP_000052.1). GSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEA
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)