
BRAF / B-Raf Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C750006-20
Catalog Number: LS-C750006
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- B-Raf antibody LS-C750006 is an unconjugated rabbit polyclonal antibody to B-Raf (BRAF) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 94 kDa B-raf protein | B-raf | BRAF1 | B Raf | BRAF | Proto-oncogene B-Raf | p94 | B-RAF1 | NS7 | ONCOGENE BRAF | RAFB1
- UniProt Number
- P15056
- NCBI GenBank
- NM_004333 | NP_004324.2
- SwissProt
- P15056
Recommended Dilution
| Application | Dilution |
|---|---|
| IF/ICC | 1:50 - 1:200 |
| IHC | 1:50 - 1:200 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human BRAF / B-Raf
- Antigen Species
- Human
- Gene Name
- BRAF
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 350-449 of human BRAF (NP_004324.2). DEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDD
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
