Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
BMP5 antibody Western blot. All lanes: Anti BMP5 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 51 kD. Observed band size: 51 kD.
BMP5 Antibody (aa332-365)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407901-100
Catalog Number: LS-C407901
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BMP5 antibody LS-C407901 is an unconjugated rabbit polyclonal antibody to BMP5 (aa332-365) from human. It is reactive with human, mouse, rat and other species. Validated for ELISA, IHC and WB.
- Application
- ELISA, IHC, IHC-P, WB
- Reactivity
- Bov, Can, Hu, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BMP5 | BMP-5 | Bone morphogenetic protein 5
- Recommended Dilution: ELISA
- 0.1 - 0.5 ug/ml
- UniProt Number
- P22003
- NCBI GenBank
- NM_021073 | NP_066551.1
- SwissProt
- P22003
Target
- Target
- Human BMP5
- Antigen Species
- Human
- Epitope
- Expressed in the lung and liver.
- Gene Name
- BMP5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human BMP-5 (332-365 aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
