Bmi1 antibody Western blot. All lanes: Anti BMI1 at 0.5 ug/ml. WB: Recombinant Human BMI1 Protein 0.5ng. Predicted band size: 37 kD. Observed band size: 37 kD.
BMI1 / PCGF4 Antibody (aa135-165)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Horse, Human, Mouse, Non-Human Primate, Pig, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C343996-100
Catalog Number: LS-C343996
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PCGF4 antibody LS-C343996 is an unconjugated rabbit polyclonal antibody to PCGF4 (BMI1) (aa135-165) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Hr, Hu, Ms, NHP, Por, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BMI1 | BMI-1 | Flvi-2/bmi-1 | FLVI2/BMI1 | PCGF4 | Polycomb group protein Bmi1 | Polycomb complex protein BMI-1 | Dna-binding protein bmi-1 | Polycomb group ring finger 4 | RING finger protein 51 | RNF51
- UniProt Number
- P35226
- NCBI GenBank
- NM_005180 | NP_005171.4
- SwissProt
- P35226
Target
- Target
- Human BMI1 / PCGF4
- Antigen Species
- Human
- Gene Name
- BMI1|COMMD3-BMI1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165 aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl