LMNB2 / Lamin B2 Antibody
Catalog Number: LS-C659166-100
100 µL / $399.00
Antibody: Mouse Monoclonal
Applications: Immunoprecipitation, Western Blot
Reactivity: Human, Mouse
Format: Liquid
Western blot analysis of extracts of various cells.
BDKRB2/Bradykinin B2 Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408567-20
Catalog Number: LS-C408567
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Bradykinin B2 Receptor antibody LS-C408567 is an unconjugated rabbit polyclonal antibody to Bradykinin B2 Receptor (BDKRB2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BK-2 receptor | Bradykinin type-2 receptor | B2R | Bradykinin B2 receptor | BRB2 | BDKRB2 | BK-2R | BK-2Rs | BK2 | B2 bradykinin receptor | B2bkr | BK-2 | BKR2 | Bradykinin receptor B2
- UniProt Number
- P30411
- NCBI GenBank
- NM_000623 | NP_000614.1
- SwissProt
- P30411
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human BDKRB2/Bradykinin B2 Receptor
- Antigen Species
- Human
- Epitope
- Human BDKRB2/Bradykinin B2 Receptor
- Gene Name
- BDKRB2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 302-391 of human BDKRB2 (NP_000614.1). SSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 1.75 mg/mL
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
