Western blot - Anti-Bcl-X Picoband Antibody
BCL2L1 / BCL-XL Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Frozen, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662395-100
Catalog Number: LS-C662395
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BCL-XL antibody LS-C662395 is an unconjugated rabbit polyclonal antibody to human BCL-XL (BCL2L1). Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC, IHC-F, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Apoptosis regulator Bcl-X | Bcl-xL | BCL-XL/S | BCLXS | Bcl-2-like protein 1 | BCL2-like 1 | BCL2L | Bcl-X | Bcl-xS | BCLXL | PPP1R52 | Bcl2-L-1 | BCL2L1 | BCLX
- UniProt Number
- Q07817
- NCBI GenBank
- NM_001191 | NP_001182.1
- SwissProt
- Q07817
Target
- Target
- Human BCL2L1 / BCL-XL
- Antigen Species
- Human
- Epitope
- Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.
- Gene Name
- BCL2L1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105 aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl