Western blot testing of 1) rat liver, 2) mouse thymus, 3) human MCF7 and 4) human 22RV1 lysate with Bcl-2 antibody at 0.5ug/ml. Predicted molecular weight ~26 kDa.
BCL2 / Bcl-2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782022-100
Catalog Number: LS-C782022
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Bcl-2 antibody LS-C782022 is an unconjugated rabbit polyclonal antibody to Bcl-2 (BCL2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Apoptosis regulator Bcl-2 | BCL2 | B-cell CLL/lymphoma 2 | B-cell lymphoma protein 2 | Bcl-2 | PPP1R50
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P10415
- NCBI GenBank
- NM_000633, NP_000624.2
- SwissProt
- P10415
Target
- Target
- Human BCL2 / Bcl-2
- Antigen Species
- Hu
- Gene Name
- BCL2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Amino acids 102-140 (DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD) were used as the immunogen for the Bcl-2 antibody.
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS