
Western blot analysis of extracts of various cell lines.
BBS2 / BBS Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409154-20
Catalog Number: LS-C409154
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BBS antibody LS-C409154 is an unconjugated rabbit polyclonal antibody to BBS (BBS2) from human. It is reactive with mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Bardet-Biedl syndrome 2 | BBS | BBS2
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9BXC9
- NCBI GenBank
- NM_031885 | NP_114091.3
- SwissProt
- Q9BXC9
Target
- Target
- Human BBS2 / BBS
- Antigen Species
- Human
- Epitope
- Human BBS2 / BBS.
- Gene Name
- BBS2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human BBS2 (NP_114091.3). MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGT
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
