Detection of Ataxin-1 in COS-1 cells transfected with Ataxin-1 with Ataxin-1 Monoclonal Antibody at 5ug/ml.
ATXN1 / SCA1 Antibody (clone S76-8)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Immunofluorescence, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$548.00each
Catalog Number: LS-C759905-100
Catalog Number: LS-C759905
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SCA1 antibody LS-C759905 is an unconjugated mouse monoclonal antibody to SCA1 (ATXN1) from mouse. It is reactive with human, mouse and rat. Validated for IF and WB.
- Application
- IF, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- ATX1 | Ataxin 1 | ATXN1 | D6S504E | Ataxin-1 | SCA1
- Recommended Dilution: IF/ICC
- 10 ug/ml
- Recommended Dilution: WB
- 1 - 5 µg/ml
- UniProt Number
- P54253
- NCBI GenBank
- NM_000332 | NP_000323.2
- SwissProt
- P54253
Target
- Target
- Mouse ATXN1 / SCA1
- Antigen Species
- Mouse
- Gene Name
- ATXN1
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Clone
- S76-8
- Isotype
- IgG2b
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic peptide corresponding to aa 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. This sequence is 100% identical to rat and 88% identical to human Ataxin-1.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- PBS, pH 7.4, 0.1% Sodium Azide, 50% Glycerol
- Preservative
- Yes
- Purification Method
- Protein G Affinity
Storage & Handling
- Storage Conditions
- Store at -20°C for up to 1 year.
- Recommended Storage Buffer
- PBS