
ATXN1 / SCA1 Antibody (aa164-197, clone S76-8, Biotin)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Immunohistochemistry (general), Immunoprecipitation, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$485.00each
Catalog Number: LS-C229235-100
Catalog Number: LS-C229235
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SCA1 antibody LS-C229235 is a biotin-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
- Application
- IHC, IP, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- ATX1 | Ataxin 1 | ATXN1 | D6S504E | Ataxin-1 | SCA1
- UniProt Number
- P54253
- NCBI GenBank
- NM_000332 | NP_000323.2
- SwissProt
- P54253
Target
- Target
- Human ATXN1 / SCA1
- Antigen Species
- Human
- Epitope
- Detects a 85 kD protein.
- Gene Name
- ATXN1
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Clone
- S76-8
- Isotype
- IgG2b
Immunogen
- Immunogen
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Biotin
- Format
- Liquid
- Formulation
- PBS, pH 7.4, 0.1% Sodium Azide, 50% Glycerol
- Concentration
- 1 mg/mL
- Preservative
- Yes
- Purification Method
- Protein G Affinity
Storage & Handling
- Storage Conditions
- Store at -20°C.
- Recommended Storage Buffer
- PBS
