
Western blot analysis of extracts of various cell lines.
ATP2B2 / PMCA2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C348973-20
Catalog Number: LS-C348973
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PMCA2 antibody LS-C348973 is an unconjugated rabbit polyclonal antibody to PMCA2 (ATP2B2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ATP2B2 | PMCA2 | Plasma membrane calcium ATPase | PMCA2i | Plasma membrane Ca2+ pump 2 | Plasma membrane calcium pump | Plasma membrane Ca(2+)-ATPase | PMCA2a
- UniProt Number
- Q01814
- NCBI GenBank
- NM_001683 | NP_001674.2
- SwissProt
- Q01814
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human ATP2B2 / PMCA2
- Antigen Species
- Human
- Epitope
- Human ATP2B2 / PMCA2
- Gene Name
- ATP2B2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ATP2B2 (NP_001674.2). MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
