ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 / SERCA3 Antibody (aa1-30)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357603-100
Catalog Number: LS-C357603
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SERCA3 antibody LS-C357603 is an unconjugated rabbit polyclonal antibody to SERCA3 (ATP2A3) (aa1-30) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Calcium pump 3 | SERCA3 | SR Ca(2+)-ATPase 3 | ATP2A3 | SERCA3b
- UniProt Number
- Q93084
- NCBI GenBank
- NM_005173 | NP_005164.2
- SwissProt
- Q93084
Target
- Target
- Human ATP2A3 / SERCA3
- Antigen Species
- Human
- Epitope
- Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines. .
- Gene Name
- ATP2A3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human ATP2A3(1-30 aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl