ATP2A2 antibody Western blot. All lanes: Anti ATP2A2 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 115 kD. Observed band size: 115 kD.
ATP2A2 / SERCA2 Antibody (aa1-32)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Horse, Human, Mouse, Non-Human Primate, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357605-100
Catalog Number: LS-C357605
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SERCA2 antibody LS-C357605 is an unconjugated rabbit polyclonal antibody to SERCA2 (ATP2A2) (aa1-32) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Hr, Hu, Ms, NHP, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ATP2B | ATP2A2 | Calcium pump 2 | DAR | SR Ca(2+)-ATPase 2 | Cardiac Ca2+ ATPase | DD | SERCA2
- UniProt Number
- P16615
- NCBI GenBank
- NM_001681 | NP_001672.1
- SwissProt
- P16615
Target
- Target
- Human ATP2A2 / SERCA2
- Antigen Species
- Human
- Epitope
- Isoform 1 is widely expressed in smooth muscle and nonmuscle tissues such as in adult skin epidermis, with highest expression in liver, pancreas and lung, and intermediate expression in brain, kidney and placenta. Also expressed at lower levels in heart and skeletal muscle. Isoforms 2 and 3 are highly expressed in the heart and slow twitch skeletal muscle. Expression of isoform 3 is predominantly restricted to cardiomyocytes and in close proximity to the sarcolemma. Both isoforms are mildly expressed in lung, kidney, liver, pancreas and placenta. Expression of isoform 3 is amplified during monocytic differentiation and also observed in the fetal heart. .
- Gene Name
- ATP2A2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human SERCA2 ATPase (1-32 aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl