ATP2A1 antibody Western blot. All lanes: Anti ATP2A1 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 110 kD. Observed band size: 110 kD.
ATP2A1 / SERCA1 Antibody (aa1-32)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Non-Human Primate, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357602-100
Catalog Number: LS-C357602
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SERCA1 antibody LS-C357602 is an unconjugated rabbit polyclonal antibody to SERCA1 (ATP2A1) (aa1-32) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, NHP, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ATP2A1 | SERCA1 | ATP2A | Calcium pump 1 | SR Ca(2+)-ATPase 1
- UniProt Number
- O14983
- NCBI GenBank
- NM_004320 | NP_004311.1
- SwissProt
- O14983
Target
- Target
- Human ATP2A1 / SERCA1
- Antigen Species
- Human
- Epitope
- Skeletal muscle, fast twitch muscle (type II) fibers.
- Gene Name
- ATP2A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human SERCA1 ATPase (1-32 aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl