IHC testing of FFPE human breast cancer tissue with ATF6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

ATF6 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C781962-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ATF6 antibody LS-C781962 is an unconjugated rabbit polyclonal antibody to ATF6 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ATF6 | ATF6-alpha | ATF6A
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: P18850
NCBI GenBank: NM_007348 | NP_031374.2
SwissProt: P18850

Target

Target: Human ATF6
Antigen Species: Human
Gene Name: ATF6

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids 597-629 (AININENVINGQDYEVMMQIDCQVMDTRILHIK) from the human protein were used as the immunogen for the ATF6 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS