Western blot testing of human 1) HeLa, 2) COLO320, 3) 293T, 4) Jurkat and 5) mouse testis lysate with ASXL1 antibody at 0.5ug/ml. Predicted molecular weight ~165 kDa, observed here at ~220 kDa.

ASXL1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782088-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ASXL1 antibody LS-C782088 is an unconjugated rabbit polyclonal antibody to ASXL1 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ASXL1 | BOPS | KIAA0978 | MDS
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q8IXJ9
SwissProt: Q8IXJ9

Target

Target: Human ASXL1
Antigen Species: Human
Gene Name: ASXL1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE were used as the immunogen for the ASXL1 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS