Western blot analysis of extracts of mouse thymus, using ARL6IP5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

ARL6IP5 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C749824-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ARL6IP5 antibody LS-C749824 is an unconjugated rabbit polyclonal antibody to ARL6IP5 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Addicsin | DERP11 | Aip-5 | GTRAP3-18 | JM5 | JWA | Jmx | Hp22 | PRA2 | PRAF3 | PRA1 domain family 3 | ARL-6-interacting protein 5 | ARL6IP5 | HSPC127 | PRA1 family protein 3 | Protein JWa
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: O75915
NCBI GenBank: NM_006407 | NP_006398.1
SwissProt: O75915

Target

Target: Human ARL6IP5
Antigen Species: Human
Gene Name: ARL6IP5

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human ARL6IP5 (NP_006398.1). TFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Immunogen Type: Synthetic Peptide (Linear)