ARID1A / BAF250 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490359-100
Catalog Number: LS-C490359
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BAF250 antibody LS-C490359 is an unconjugated rabbit polyclonal antibody to human BAF250 (ARID1A). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ARID1A | BAF250 | BAF250a | BRG1-associated factor 250a | C1orf4 | BRG1-associated factor 250 | ELD | HOSA1 | Osa homolog 1 | OSA1 | OSA1 nuclear protein | SMARCF1 | MRD14 | p270 | B120 | BM029 | Brain protein 120 | C10rf4 | HELD | SWI-like protein | SWI/SNF complex protein p270
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- O14497
- NCBI GenBank
- NM_006015 | NP_006006.3
- SwissProt
- O14497
Target
- Target
- Human ARID1A / BAF250
- Antigen Species
- Human
- Gene Name
- ARID1A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR of human ARID1A were used as the immunogen for the ARID1A antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS