Arc antibody Western blot. All lanes: Anti Arc at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: Mouse Brain Tissue Lysate at 50 ug. Lane 4: PANC Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 45 kD. Observed band size: 45 kD.
ARC / Arg3.1 Antibody (aa332-366)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407965-100
Catalog Number: LS-C407965
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Arg3.1 antibody LS-C407965 is an unconjugated rabbit polyclonal antibody to Arg3.1 (ARC) (aa332-366) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ARC | KIAA0278 | Arg3.1
- UniProt Number
- Q7LC44
- NCBI GenBank
- NM_015193, NP_056008.1
- SwissProt
- Q7LC44
Target
- Target
- Human ARC / Arg3.1
- Antigen Species
- Hu
- Gene Name
- ARC
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Arc (332-366 aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl