
IHC staining of FFPE mouse lung with AQP5 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
AQP5 / Aquaporin 5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782192-100
Catalog Number: LS-C782192
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Aquaporin 5 antibody LS-C782192 is an unconjugated rabbit polyclonal antibody to Aquaporin 5 (AQP5) from mouse. It is reactive with mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AQP5 | Aquaporin-5 | AQP-5 | Aquaporin 5
- UniProt Number
- P55064
- NCBI GenBank
- NM_001651 | NP_001642.1
- SwissProt
- P55064
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Mouse AQP5 / Aquaporin 5
- Antigen Species
- Mouse
- Gene Name
- AQP5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids NSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR were used as the immunogen for the AQP5 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
