Aquaporin 2 antibody Western blot. All lanes: Anti Aquaporin 2 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Kidney Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Lane 5: PANC Whole Cell Lysate at 40 ug. Predicted band size: 29 kD. Observed band size: 50 kD.
AQP2 / Aquaporin 2 Antibody (aa241-271)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407686-100
Catalog Number: LS-C407686
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Aquaporin 2 antibody LS-C407686 is an unconjugated rabbit polyclonal antibody to Aquaporin 2 (AQP2) (aa241-271) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AQP-CD | ADH water channel | Aquaporin 2 (collecting duct) | AQP-2 | Aquaporin 2 | Aquaporin-CD | AQP2 | Aquaporin-2 | Water-channel aquaporin 2 | WCH-CD
- UniProt Number
- P41181
- NCBI GenBank
- NM_000486 | NP_000477.1
- SwissProt
- P41181
Target
- Target
- Human AQP2 / Aquaporin 2
- Antigen Species
- Human
- Epitope
- Expressed in renal collecting tubules.
- Gene Name
- AQP2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Aquaporin 2 (241-271 aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl