Western blot analysis of extracts of various cell lines, using AQP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
AQP1 / Aquaporin 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C750004-20
Catalog Number: LS-C750004
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Aquaporin 1 antibody LS-C750004 is an unconjugated rabbit polyclonal antibody to Aquaporin 1 (AQP1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AQP1 | Aquaporin-1 | AQP-1 | AQP-CHIP | Aquaporin 1 | Aquaporin-CHIP | CHIP28 | Colton blood group | Urine water channel | CO
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P29972
- NCBI GenBank
- NM_198098 | NP_932766.1
- SwissProt
- P29972
Target
- Target
- Human AQP1 / Aquaporin 1
- Antigen Species
- Human
- Gene Name
- AQP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human AQP1 (NP_932766.1). AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS