Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Flow Cytometry analysis of A549 cells using anti-APRT antibody. Overlay histogram showing A549 cells stained with anti-APRT antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
APRT Antibody (aa5-49)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Frozen, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662161-100
Catalog Number: LS-C662161
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- APRT antibody LS-C662161 is an unconjugated rabbit polyclonal antibody to human APRT (aa5-49). Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC, IHC-F, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- APRT | AMP | AMP diphosphorylase | APRTD | AMP pyrophosphorylase | Transphosphoribosidase
- UniProt Number
- P07741
- NCBI GenBank
- NM_000485 | NP_000476.1
- SwissProt
- P07741
Target
- Target
- Human APRT
- Antigen Species
- Human
- Gene Name
- APRT
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human APRT (5-49 aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
