APH1a antibody Western blot. All lanes: Anti APH1a at 0.5 ug/ml. Lane 1: Mouse Lung Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: SW620 Whole Cell Lysate at 40 ug. Lane 4: SMMC Whole Cell Lysate at 40 ug. Lane 5: Human Placenta Tissue Lysate at 50 ug. Predicted band size: 29 kD. Observed band size: 29 kD.
APH1A / APH-1 Antibody (aa236-265)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407635-100
Catalog Number: LS-C407635
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- APH-1 antibody LS-C407635 is an unconjugated rabbit polyclonal antibody to APH-1 (APH1A) (aa236-265) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Aph-1alpha | APH1A | APH-1 | CGI-78 | PSF | APH-1A | Gamma-secretase subunit APH-1A
- UniProt Number
- Q96BI3
- NCBI GenBank
- NM_016022 | NP_057106.2
- SwissProt
- Q96BI3
Target
- Target
- Human APH1A / APH-1
- Antigen Species
- Human
- Epitope
- Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. Isoform 1 and isoform 2 are nearly expressed at the same level. .
- Gene Name
- APH1A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human APH1a (236-265 aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl