Western blot - Anti-APC2 Picoband Antibody
APCL / APC2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662327-100
Catalog Number: LS-C662327
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- APC2 antibody LS-C662327 is an unconjugated rabbit polyclonal antibody to human APC2 (APCL). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- APC2 | Adenomatosis polyposis coli 2 | APC-like | APCL
- UniProt Number
- O95996
- NCBI GenBank
- NM_005883 | NP_005874.1
- SwissProt
- O95996
Target
- Target
- Human APCL / APC2
- Antigen Species
- Human
- Epitope
- Widely expressed (at protein level). Specifically expressed in the CNS. .
- Gene Name
- APC2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human APC2 (51-90 aa KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK), different from the related mouse sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl