FE65 antibody Western blot. All lanes: Anti FE65 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: U87 Whole Cell Lysate at 40 ug. Predicted band size: 65 kD. Observed band size: 65 kD.
APBB1 / FE65 Antibody (aa21-56)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407896-100
Catalog Number: LS-C407896
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FE65 antibody LS-C407896 is an unconjugated rabbit polyclonal antibody to FE65 (APBB1) (aa21-56) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, GP, Hr, Hu, Ms, Por, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- APBB1 | FE65 | Adaptor protein FE65a2 | Protein Fe65 | Stat-like protein | MGC:9072 | RIR
- UniProt Number
- O00213
- NCBI GenBank
- NM_001164 | NP_001155.1
- SwissProt
- O00213
Target
- Target
- Human APBB1 / FE65
- Antigen Species
- Human
- Epitope
- Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease. .
- Gene Name
- APBB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human FE65 (21-56 aa ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl