
Western blot testing of human 1) placenta and 2) Jurkat lysate with JUND antibody at 0.5ug/ml. Predicted molecular weight: ~39 kDa (JUND-L), 34 kDa (JUND-S). (1)
AP-1 / JUND Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782139-100
Catalog Number: LS-C782139
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- JUND antibody LS-C782139 is an unconjugated rabbit polyclonal antibody to JUND (AP-1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Activator protein 1 | AP-1 | JUND | JunD-FL isoform | Jun D proto-oncogene | Transcription factor jun-D
- UniProt Number
- P17535
- NCBI GenBank
- NM_005354 | NP_005345.3
- SwissProt
- P17535
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human AP-1 / JUND
- Antigen Species
- Human
- Gene Name
- JUND
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY from the human protein were used as the immunogen for the JUND antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
