Western blot testing of human 1) HeLa and 2) A549 cell lysate with Annexin VIII antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
ANXA8 / Annexin A8 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782781-100
Catalog Number: LS-C782781
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Annexin A8 antibody LS-C782781 is an unconjugated rabbit polyclonal antibody to human Annexin A8 (ANXA8). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Annexin A8 | Annexin-8 | ANX8 | ANXA8 | Vascular anticoagulant-beta | Annexin VIII | VAC-beta
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P13928
- NCBI GenBank
- NM_001040084 | NP_001035173.1
- SwissProt
- P13928
Target
- Target
- Human ANXA8 / Annexin A8
- Antigen Species
- Human
- Gene Name
- ANXA8|ANXA8L1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS