Western blot - Anti-Annexin VIII Picoband Antibody
ANXA8 / Annexin A8 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662264-100
Catalog Number: LS-C662264
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Annexin A8 antibody LS-C662264 is an unconjugated rabbit polyclonal antibody to human Annexin A8 (ANXA8). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Annexin A8 | Annexin-8 | ANX8 | ANXA8 | Vascular anticoagulant-beta | Annexin VIII | VAC-beta
- UniProt Number
- P13928
- NCBI GenBank
- NM_001040084 | NP_001035173.1
- SwissProt
- P13928
Target
- Target
- Human ANXA8 / Annexin A8
- Antigen Species
- Human
- Gene Name
- ANXA8|ANXA8L1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Annexin VIII (20-61 aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl